PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_003455
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family ZF-HD
Protein Properties Length: 241aa    MW: 26992.1 Da    PI: 7.2331
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_003455genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.61.1e-3161115358
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                   +rY+eClkNhA+ lGghavDGC+Efmp+ g++gt +alkCaAC+CHRnFHR+e +
  DCAR_003455  61 PCRYRECLKNHAVGLGGHAVDGCCEFMPA-GDDGTLDALKCAACNCHRNFHRKEIN 115
                  589*************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2263113IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.4E-2863114IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.6E-2863114IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.85664113IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.8E-28166237IPR009057Homeodomain-like
SuperFamilySSF466891.79E-16173236IPR009057Homeodomain-like
TIGRFAMsTIGR015651.5E-26179235IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MEFEEQPEDA DQATHELPHS HPPPSYDSVT LNNNNNGNNS AYQARVSPLM QLDSPASGRK  60
PCRYRECLKN HAVGLGGHAV DGCCEFMPAG DDGTLDALKC AACNCHRNFH RKEINPNFPL  120
SPHLPQHPHF VPYYRSPSGY LHVATPTSQR PLALPSSSGG GMSSQEQEEN MTSSGGLLRK  180
RHRTKFTPEQ KEKMMSLAER LGWRIQREDD EAVKCFCEET GVSRHVLKVW MHNNKHVHSW  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A1e-281782361674ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469839.11e-84PREDICTED: zinc-finger homeodomain protein 2 isoform X1
TrEMBLA0A0D2NW201e-84A0A0D2NW20_G
STRINGVIT_18s0001g07140.t017e-76(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-66homeobox protein 22